SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G042800.1|PACid:26815911 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G042800.1|PACid:26815911
Domain Number 1 Region: 63-293
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.19e-87
Family Inorganic pyrophosphatase 0.000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G042800.1|PACid:26815911
Sequence length 297
Sequence
MAAAATARIVSVAGSSTVASSSCLLLKAPFALKHGRNALSFNNGRRLSKRLFSCNAIYNP
QVQIKHEGQPETLDYRVFFEDTSGKKISPWHDIPLHLGDGVFNFIVEIPKESSAKMEVAT
DEPYTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSLANSEVDGAFGDNDPVDVVEIG
ETRRKIGEILKVKPLAALAMIDEGELDWKIVAISLDDPRASLVNDVDDVEKHFPGTLTAI
RDWFRDYKIPDGKPANKFGLGNKAANKEYALKVITETNESWAKLVKRSIPAGELSLA
Download sequence
Identical sequences A0A0D2SUI7
Gorai.008G042800.1|PACid:26815911 XP_012436481.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]