SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G066900.1|PACid:26818371 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G066900.1|PACid:26818371
Domain Number 1 Region: 31-221
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.68e-62
Family Inorganic pyrophosphatase 0.00000604
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G066900.1|PACid:26818371
Sequence length 226
Sequence
MANNGGEATSGKSAGFSRVALNERILSSMTRRSIAAHPWHDLEIGPGAPAVFNCVVEIGK
GSKVKYELDKTSGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPGSF
LRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKQLPPHRLAEIRRFFEDCIHSHV
YLILSYKKNENKKVDVEDFLPAETAIEAIKYSMDLYASYIVESLRK
Download sequence
Identical sequences A0A0D2SVW1
Gorai.008G066900.1|PACid:26818371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]