SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G066900.2|PACid:26818372 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G066900.2|PACid:26818372
Domain Number 1 Region: 41-220
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.27e-66
Family Inorganic pyrophosphatase 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G066900.2|PACid:26818372
Sequence length 225
Sequence
MEKFLSIERSMANNGGEATSGKSAGFSRVALNERILSSMTRRSIAAHPWHDLEIGPGAPA
VFNCVVEIGKGSKVKYELDKTSGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLIL
MQEPVLPGSFLRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKQLPPHRLAEIRR
FFEDYKKNENKKVDVEDFLPAETAIEAIKYSMDLYASYIVESLRK
Download sequence
Identical sequences A0A0D2T1C6
XP_012436869.1.20347 Gorai.008G066900.2|PACid:26818372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]