SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G066900.8|PACid:26818378 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G066900.8|PACid:26818378
Domain Number 1 Region: 31-152
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.31e-30
Family Inorganic pyrophosphatase 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G066900.8|PACid:26818378
Sequence length 157
Sequence
MANNGGEATSGKSAGFSRVALNERILSSMTRRSIAAHPWHDLEIGPGAPAVFNCVVEIGK
GSKVKYELDKTSGLIKGEKDDKIIAVCADDPEFRHYTDIKQLPPHRLAEIRRFFEDYKKN
ENKKVDVEDFLPAETAIEAIKYSMDLYASYIVESLRK
Download sequence
Identical sequences A0A0D2PPT1
Gorai.008G066900.8|PACid:26818378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]