SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G132200.2|PACid:26816678 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G132200.2|PACid:26816678
Domain Number 1 Region: 20-176
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.93e-62
Family Inorganic pyrophosphatase 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G132200.2|PACid:26816678
Sequence length 181
Sequence
MFDITFIHTSKFWFLCSTGQVVEIAKGSKVKYELDKKTGMIKVDRVLYSSVVYPHNYGFI
PRTLCEDNDPLDCLVIMQEPVVPGCFVRARALGLMPMIDQGEKDDKIIAVCADDPEYKHY
TDIKELPPHRLTEIKRFFEDYKKNENKEVAVNDILPSSTAFEAIQHSMDLYGEYLLQTLS
K
Download sequence
Identical sequences A0A0D2U2C2
Gorai.008G132200.2|PACid:26816678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]