SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G246300.4|PACid:26814300 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G246300.4|PACid:26814300
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.3e-21
Family Glutathione S-transferase (GST), N-terminal domain 0.00058
Further Details:      
 
Domain Number 2 Region: 83-178
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.000000000518
Family Glutathione S-transferase (GST), C-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G246300.4|PACid:26814300
Sequence length 214
Sequence
MKLKVYADRMSQPSRAVIIFCKVNGIDYEEIKVHISKGQHLTPEFAEINPMKQLPAIADG
RFKLFESHAILIYLACAFPGVADQWYPADVFKRSKIHSVLDWHHSNLRRGAESFWLKGNG
RFLLGGNQPSIADLSLVCELTQLEVLDEKDRTRLLGPHKKVQQWIENTRNATNPHFDEVH
RVIMLAKERQQHQRLKAAKNEGGSNMKKPLVSRM
Download sequence
Identical sequences A0A0D2TC47
Gorai.008G246300.4|PACid:26814300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]