SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.009G262000.1|PACid:26765169 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G262000.1|PACid:26765169
Domain Number 1 Region: 72-282
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 1.02e-60
Family Chlorophyll a-b binding protein 0.00000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G262000.1|PACid:26765169
Sequence length 291
Sequence
MASLAASTAAASLGVSEMLGNPLNFSGGARSSAPTPSNSSTFKTVALFSKKKAAPPKPKA
AAVAPADEELAKWYGPDRRIFLPEGLLDRSEIPEYLNGEVPGDYGYDPFGLSKKPEDFAK
YQAYELIHARWAMLGAAGFIIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPI
NLVVAVVAEVVLVGGAEYYRIINGLDLEDKLHPGGPFDPLGLAKDPDQAALLKVKEIKNG
RLAMFAMLGFFLQAYVTGEGPVENLSKHLSDPFGNNLLTVIAGTAERAPTL
Download sequence
Identical sequences A0A0B0P4T9 A0A0D2TRX6 A0A1U8PLB0
XP_012446331.1.20347 XP_016751118.1.88148 XP_017634880.1.75545 Gorai.009G262000.1|PACid:26765169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]