SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.009G424300.6|PACid:26763193 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G424300.6|PACid:26763193
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.97e-70
Family Inorganic pyrophosphatase 0.00000455
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G424300.6|PACid:26763193
Sequence length 187
Sequence
MTRRSVAAHPWHDLEIGPGAPTVFNCVIEIGKGSKVKYELDKKTGLIKVDRVLYSSVVYP
HNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPMIDQGEKDDKIIAVCADD
PEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPASTAYEAIQHSMNLYADY
IVESLRR
Download sequence
Identical sequences A0A0D2TGJ2
Gorai.009G424300.6|PACid:26763193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]