SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.012G161500.1|PACid:26827023 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.012G161500.1|PACid:26827023
Domain Number 1 Region: 61-291
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-85
Family Inorganic pyrophosphatase 0.000000438
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.012G161500.1|PACid:26827023
Sequence length 295
Sequence
MAAAARVIAIAGNSTAAASSCLLIKTPFALQRCSNGLRFNNVRRSSKRLFSCNAIYNPQV
QIKREGQPETLDYRVFFEDNSGKKISPWHDVPLHLGDGVFSFIVEIPKESSAKMEVATDE
LYTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSLANSEVEGAFGDNDPVDVVEIGES
RRKIGDILKVKPLAALAMIDEGELDWKIVAISLDDPRASLVNDIDDVEKHFPGTLTAVRD
WFRDYKIPDGKPANKFGLGNKAANKDYALKVITETNESWAKLVKRSIPAGELSLV
Download sequence
Identical sequences A0A0D2UZL6
XP_012459452.1.20347 XP_012459453.1.20347 Gorai.012G161500.1|PACid:26827023 Gorai.012G161500.3|PACid:26827024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]