SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.012G161500.2|PACid:26827025 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.012G161500.2|PACid:26827025
Domain Number 1 Region: 61-248
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.02e-63
Family Inorganic pyrophosphatase 0.00000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.012G161500.2|PACid:26827025
Sequence length 252
Sequence
MAAAARVIAIAGNSTAAASSCLLIKTPFALQRCSNGLRFNNVRRSSKRLFSCNAIYNPQV
QIKREGQPETLDYRVFFEDNSGKKDTKKGKLRYYPYNINWNYGLLPQTWEDPSLANSEVE
GAFGDNDPVDVVEIGESRRKIGDILKVKPLAALAMIDEGELDWKIVAISLDDPRASLVND
IDDVEKHFPGTLTAVRDWFRDYKIPDGKPANKFGLGNKAANKDYALKVITETNESWAKLV
KRSIPAGELSLV
Download sequence
Identical sequences Gorai.012G161500.2|PACid:26827025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]