SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.013G106400.1|PACid:26788137 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G106400.1|PACid:26788137
Domain Number 1 Region: 81-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.61e-25
Family Thioltransferase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G106400.1|PACid:26788137
Sequence length 162
Sequence
MCCKATFIFLLLRRSICRHLEHPINPIYHSNHLYLFHTHLLANPKNPGSSAKIVKQLQLK
RLPKRPGQSLWLAVTHQFWWEFWAPWCGPCWMIEPVIAELAREYAGKISRNKLNTDDSPN
NATQFGIRSIPTIMFFKNGEECIIGAVPKSSLAASIEKYIDN
Download sequence
Identical sequences A0A0D2VDF0
Gorai.013G106400.1|PACid:26788137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]