SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.001G072800.1|PACid:26819896 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.001G072800.1|PACid:26819896
Domain Number 1 Region: 162-238
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000731
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 2 Region: 260-291
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000994
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 98-129
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000602
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 35-61
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.001G072800.1|PACid:26819896
Sequence length 295
Sequence
MDTRKRGRREAGFNANGGIKKSKPELESLSTGVGSKSKPCTKFFSTAGCQFGESCHFLHY
VPGGYNAVSQMMNLAPAVQPASRNVAATAAIPHGSASAVKTRLCNKFSSPEGCKFGDKCH
FAHGEWELGTPIAPSLDDPRSMAPLPGRMGSRMEPPPPSGPAATFGASATAKISVDASLA
GAIIGKGGVHSKQICRQTGAKLSIREHESDPSLRNIELEGSFEQIKEASAMVRELISSLG
PVPGPAKTAGAHGGQGHPGSNYKTKLCDNFAKGSCTFGERCHFAHGAAELRKSVV
Download sequence
Identical sequences A0A0D2QIF2
Gorai.001G072800.1|PACid:26819896 XP_012469689.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]