SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.002G034300.1|PACid:26793208 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.002G034300.1|PACid:26793208
Domain Number 1 Region: 456-748
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-78
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 94-202
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-24
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Weak hits

Sequence:  Gorai.002G034300.1|PACid:26793208
Domain Number - Region: 397-440
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0589
Family Hairpin loop containing domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G034300.1|PACid:26793208
Sequence length 823
Sequence
MGPIIRAVPPISLAPLVPPIRTPPPGCSVLLSLISCFYLLFATALDTITPSKSIKDPEFI
ISQNGTFRLGFFSLANSSNRYVGILYHQIPVQTVVWVANRNRPLKDSSGILNISDDGNLV
VLNGKTETLWSSNVTNTAPNVTTAHLSDLGNLVLSNGDDAGSSLWESFQHPSNAFIESME
ISTDVKKGRKVEIKSWKSHDDPSDGNFSFGIEPFNVPEFVIWNNNQLYFRSGPWNGNMFI
GLILPTVAFSWFSVVADNRQQTFFIGYEDSNHSMLTYCELDSQGKFSERRWDAEKGNWIK
SYSIYHTDCDVYGKCGEFGMCNSKKRPICSCLKGFKPRNAEEWSRGNWSSGCFRTTPLQC
QRDNNNGSGAGKGDDGFLEMKMMNVPAFPDRSSIVNGECKDQCLKNCSCVAYAYDAGIGC
MMWSGDLIDVKESSRGVDLYIRLPASELENSIGVKLQQLPLFNFEELATATNNFNHAKML
GQGGFGPVYRGTLDDGKEIAVKRLSKASGQGLEEFMNEVVVISKLQHRNLVRLLGCCVEG
EEKMLAYEYMPNKSLDALLFDPAKQDVLDWRKRFNIIEGISRGLLYLHRDSRLKIIHRDL
KASNILLDEELNPKISDFGMARIFGGNQNQANTKRVVGTYGYMSPEYVMRGQFSEKSDVF
SFGVLLLEVVSGRRNTSFCNDQYALSLLGYAWKLWREGDICGIVDKVILESETYSKNGNE
KEIWRCIHDGLVCVQEFAKDRPTMPTVRASEVDNAVVACFLELQVITPEPRVKTNVDTLL
LSSRELAQSLFVNPHNLKSEVFEYQMPYSKVPAMYRKTRFAAP
Download sequence
Identical sequences Gorai.002G034300.1|PACid:26793208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]