SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.002G193200.1|PACid:26795041 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.002G193200.1|PACid:26795041
Domain Number 1 Region: 95-378
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.52e-40
Family Ankyrin repeat 0.00047
Further Details:      
 
Domain Number 2 Region: 9-57,93-119
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000144
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.002G193200.1|PACid:26795041
Sequence length 524
Sequence
MCGLDANATDRLLRRSSKPSLYTNIDCNALSAAVICRQISIVRSLLQAGIKTGLKVRVGA
WSWDIDTGEETRVGAGLAEAYSITWCAVEYFEDLIHRAILSNNVSAVEVLLNCGADIEFP
VKTTSKTALRPIHLSAKLGFVEVLQCLIVAGCDIDSRTAFGDSLLMICARYKHGDCLKVL
ASAGADFGLVNSAGQSASSIAGLTRWNHGFQQAVQDVILAGKTPQSSNPSVFSPLMFTAR
GNEIEALKKLLERADVDLYEQDDDGNSALMIAASGGHLEAFELLLRAGANIKLSNKYGDT
SISLLELNQKGDAFDQLMLEYAHEDGNGPIWFYALHRAVKRGDLNLVHILTSRGYDVNAF
DADGYTPLTLAARGGYIKNARHETTLLLARKKWYGNDTEIVILNELARALVVDGSQVKKH
SRGGKGSPHSNVLRMMETRGIPRGGKSSRRNVICKAAEVGPGEKFRWNRRRKFDVEESGM
FHVVTTKNNEVHFVCDGGIQMAELWVRGILLVTSEAIFGKPKQV
Download sequence
Identical sequences A0A0D2MD19
Gorai.002G193200.1|PACid:26795041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]