SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.003G085800.1|PACid:26797618 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G085800.1|PACid:26797618
Domain Number 1 Region: 80-236
Classification Level Classification E-value
Superfamily IpsF-like 4.97e-58
Family IpsF-like 0.00000835
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G085800.1|PACid:26797618
Sequence length 237
Sequence
MATRFYSCSLIPARPTSGSVLNKYSLLPNPRISITRRHTTLVSSSSSSSSFTLRASVSSA
ATSTAVDGTISSTKPSKSLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDVL
LHCVVDAILGALGLPDIGQIFPDSDPKWKGAPSSVFIKEAVRLMHEAGYEIGNLDATLIL
QRPKLSPHKGVIKANLSELLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVVLLMRK
Download sequence
Identical sequences A0A0D2QHJ5 A0A1U8NKY9
Gorai.003G085800.1|PACid:26797618 XP_012470543.1.20347 XP_016739656.1.88148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]