SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.003G126000.1|PACid:26799529 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.003G126000.1|PACid:26799529
Domain Number 1 Region: 467-759
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-77
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 69-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.12e-21
Family alpha-D-mannose-specific plant lectins 0.0034
Further Details:      
 
Weak hits

Sequence:  Gorai.003G126000.1|PACid:26799529
Domain Number - Region: 149-250
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000131
Family alpha-D-mannose-specific plant lectins 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.003G126000.1|PACid:26799529
Sequence length 837
Sequence
MSLSFFLFLYLLTSFFIASSATISLGSSITPSSPRLTWHSSNSTFSISFIPSASSNSLLA
AITYAGGVPIWTAGNGTTVDSAGSLRLLSNGALHLVNGSGAVVWDSGTANQGVSSASLEE
SGELRLLGNGSSVVWSSFDHPTDTIVPTQNFTVGRVLRSGLYTFYLQRSGNLTLRWNDSI
VYWTQGLNSSFDANLTSPSLGLQTIGILNLFDPSLSTGSIVAYSSDYAEGSNILRFLRLD
EDGNLRIYSSSQGSGTITPRWSAVLDQCDVFGYCGNMGICSYNDTSPICGCPSENFELVD
VNDRRQGCKRKREIEDCPGSAAMLELDHAEFLTYSPELSSQVFFIGISACRLNCLVSASC
VASTSLSDGSGVCYLKTTEFVSGYQSASLPSTSYVKVCGPILPNPSPFADNVENGSGWRV
HGWVVVVVIVATVLVLIALEGSLWWWCCRNSPKFGGLSAQYALLEYASGAPVQFSYKELQ
RLTKGFKEKLGAGGFGAVYKGVLANRTVMAVKQLEGIEQGEKQFRMEVATISSTHHLNLV
RLIGFCSEGRHRLLVYEFMKNGSLDNFLFTTEEHSGKMLSWEYRYNVALGTARGITYLHE
ECRDCIVHCDIKPENILLDENFNAKVSDFGLAKLINPKDHRYRTLTSVRGTRGYLAPEWL
ANLPITSKSDVYSYGMVLLEIVSGRRNFDVSADTNRKKFSVWAYEEFEKGNIEGIVDKKL
RSKDVDMEQITRAIQVSFWCIQEQPSHRPMMGKVVQMLEGITDIERPPAPKAATEGSISG
TSINVSSNISAFSTFAVSAPAPSSSSSLQTVGISPLASGMISSEKQSSSLIQPDMKC
Download sequence
Identical sequences A0A0D2RLH1
Gorai.003G126000.1|PACid:26799529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]