SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.004G018300.1|PACid:26775824 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G018300.1|PACid:26775824
Domain Number 1 Region: 150-250
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.06e-27
Family B3 DNA binding domain 0.00013
Further Details:      
 
Domain Number 2 Region: 37-93
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000131
Family GCC-box binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G018300.1|PACid:26775824
Sequence length 350
Sequence
MAATKTSRSGGGSGGDDYMFRASKRLKTETSGGLARFKGIAPQQNGHWGAQIYANHQRIW
LGTFKSENEAALAYDSAAIGLRIGDPHRNFPWSYDNIQEPNFQNLHTTRDILNMIKSGSY
QSKYADYTKSSANHNKNTIHNDTKFACQQLFQKELTPSDVGKLNRLVIPKKHAVKHFPHI
ENDHQTFTTANGGCEDVELVFYDTSMKMWRFRYCYCKSSQSFVFTRGWNRFVKDKKLKEK
DAIAFYTCECTGEIEHGRGFFLIDVNYNGGDDENGGRIDVFKRLGSSSVLRHHQGELHVG
LELNLGTNFYCNLDEKHNENGEEQGLSGLKSSSSHSVKEKRITLFGARIN
Download sequence
Identical sequences A0A0D2QXJ0
XP_012472976.1.20347 Gorai.004G018300.1|PACid:26775824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]