SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G024400.1|PACid:26774932 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G024400.1|PACid:26774932
Domain Number 1 Region: 459-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.12e-77
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 76-152
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-16
Family alpha-D-mannose-specific plant lectins 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G024400.1|PACid:26774932
Sequence length 807
Sequence
MAAFSIFVFLSGLFVTSSGGLYSHSIRPNFTASFITLVDNSGAFLLSPNATFRAAISNYP
DQQLPQFYFSIIHSSTNTIIWTANRGRPVSDSAKVLLTPNGLVITNNFDQIVWSTPSLDS
PVAFLQLDDSGNLILLDQQNISLWESFNYPTDTLWNGMTYWQLSMDNQAFKESNVLMSFM
AVNGSGLYWVGDDGSTIVFKVPLAPIDAAGLEFIYAKLGSNGKFTISSFDGNNLIPNLQI
PVENCRTPSICEKIGFCNGDKRPETCLCPSAFHNGIDGCVPINPLLTLPKACNTSNSYGN
ETNNQVSYMEIGDAIDYFSTNFIEPLSQRISLLNCQLLCSRNCSCLGVLYGNSSGSCYPI
WNNVGSIFSSTFGLGQDFSGYVKAMTLSSNINLSSKTDTDNKFSVLGSVLIPSLGTLVLV
VLVIGFSWWKTRKWHSRAAVVRLGSKASFSMEIDLLSIAGLPVKFEYEELATATDNFTTQ
IGSGGFGTVYRGVLPDESVVAVKRITNLGVEGKKDFCTEIAIIGNIHHINLVKLKGFCLQ
GKQRFLVLEYMNKGSLDHVIFNNESVLEWKERFKIAVGTARGLAYLHSGCQHKIIHCDVK
PENILLHEENLHQNLQVKISDFGISKLLTPEQSNLLTTLRGTRGYLAPEWLTSSGISEKS
DVFSYGMVLLEIVRGRRNFSIQPCAPLSGTELKRLYFPLLALEMHEQKRYMELVDPKLNG
RAESDEVERLVQVALCCVQMQPWQRPTMSNVVGMLEGSLPVEQPRIESLNFLRIYGGRYA
SVLTTSTDGCNEQNEFIMDYHQSSNDC
Download sequence
Identical sequences A0A0D2QXV5
XP_012473056.1.20347 Gorai.004G024400.1|PACid:26774932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]