SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G041200.1|PACid:26771749 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G041200.1|PACid:26771749
Domain Number 1 Region: 609-801
Classification Level Classification E-value
Superfamily Sec7 domain 5.76e-77
Family Sec7 domain 0.00000148
Further Details:      
 
Domain Number 2 Region: 403-547,835-956,1130-1298,1332-1510
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000124
Family Armadillo repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G041200.1|PACid:26771749
Sequence length 1780
Sequence
MASAEADSRISLLVVPALEKIIKNASWRKHSKLSHECKSILKTLTSPSPPPSSASPSDSE
PENSIPGPINDGGQVEYSLAESKSILSPLINACATSFNKIVDPAVDCIQKIIAHGYLRGE
ADPTGGPEAQLLSKLIESVCKCHAVGDESIELLVLKTLLTAVTSISLRIHGDCLLQTVRT
CYDIYLGTKNAVNQTTAKATLIQMLVVVFRRMEADSSTVPVQPIVVAELMGPIEKSDADG
SMTHFVQGFITKIMQDIDGVFNPATPSKISLGGHDGAFDTTTVETTNPTDLLDSTDKDML
DAKYWEISMYKTALEGRKGELADEEAERDDDLEVQIGNKLRRDAFLVFRALCKLSMKTPP
KEALADPQLMRGKIVALELLKIFLENAGAAFRTSERFLGAIKQYLCLSLLKNSASTLIIV
FQLSCSIFISLVSRFRAGLKAEIGVFFPMIVLRVLENVAQPNFQQKMIVLRFLDKLCVDS
QILVDIFINYDCDVNSSNIFERMVNGLLKTAQGVPPGTATTLLPPQQATMKFEAMKCLVA
ILKSMGGWMNKQLRIPDPYSTKRFEAAENSLEPGTVPMENGNGDEPAEGSDSQSEAINES
SEILTIEQRRAYKLELLEGISLFNRKPEKGIEFLIKARKVGNSPEEIAAFLKNTSGLKKT
LIGDYLGEREDLPLKVMHAYVDSFDFQGMEFDEAIRAFLQGFRLPGEAQKIDRIMEKFAE
RYCKCNPKAFISADTAYVLAYSVIMLNTDAHNPMVKNKMSADDFIRNNRGIDDGKDLPEE
CLRSLFERISRNEIKMKDDDLSMLQKQSMNSNRILGLDNILNIVIRKSDEDEHMETSDDF
IRHMQEQFKEKARKSESVYYAATDVVILRFMVEASWAPMLAAFSVPLDQSDDEEVTALCI
EGFCCAIHITAVMCMKTHRDAFLTSLAKFTSLHSPADIRQKNIDAIKAIATIADEDGNYL
QEAWEHILTCVSRFEHLHLLGEGAPPDATFFSFSQNESEKSKQAKSAGLPVIRKKGSGRI
QYAAAAVMRGSYDSAGIGGNTGTITSEQMNNLVSNLDMLEQVGSSEMNRIFTRSQKLNSE
AIIDFVKALCKVSMEELRSTSDPRVFSLTKIVEIAHYNMNRIRLVWSSIWLVLSDFFVTI
GCSENLSIAIFAMDSLRQLSMKFLEREELANYNFQNEFMKPFVIAMQKSSAVEIRELIIR
CVSQMVSSRVNNVKSGWKSMFMVFTTAAYDNHKNIVLLAFEVTEKIIRDYFPYITETETT
TFTDCVNCLIAFTNNRFNKDISLNAIAFLRFCATKLAEGDLSSASIKTDKESGNTSQSSP
SKGKDGKQENGELIDKDDHLYFWLPLLAGLSKLGFDPRPEIRESALQVLFETLSNHSHLF
SLPLWEKVFESVLFPIFEYVRHAIDPSGGDPPEQGIDSEMSEIDQDAWLYETCTLALQLL
VDLFASFYNTVNPLLPKVLSLLVSFIKRPHQSLAGIGIAAFVRLMTNSGNLFLEEKWLEV
VSSIREAVNATLPDFSYFVSGDITLEGNGHVLNDQSNEASHGSDTSRGDSESLGKQRLYA
SLSDTKCRAAIQLLLIQATMEIYNMHRTRISAKNILVLVDAMHDVASHAHGINNDAILRT
KLLEFGRMTQMQDPPLLRLENESYQFCLTFLHNLILDRPPSFEEAEIESHIVGLCQEVLL
FYIESACSGQTSVTSADGQTQWLIPLGSGKRKELAARAPLVVVTLQTICTLGDTLFEKNL
AKFFPLLSNLISCEHGSNEVQAALSDMLNSSVGPLLLQSC
Download sequence
Identical sequences A0A0D2MTF9
XP_012473349.1.20347 Gorai.004G041200.1|PACid:26771749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]