SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G155500.2|PACid:26771935 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G155500.2|PACid:26771935
Domain Number 1 Region: 2084-2373
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-120
Family BEACH domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 2497-2565,2604-2718,2754-2801
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.53e-28
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 3 Region: 1962-2072
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-22
Family PreBEACH PH-like domain 0.0025
Further Details:      
 
Weak hits

Sequence:  Gorai.004G155500.2|PACid:26771935
Domain Number - Region: 326-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000348
Family Clostridium neurotoxins, the second last domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G155500.2|PACid:26771935
Sequence length 2815
Sequence
MENDYSSTSELRHDSDYSSLGSPIKPKPKADMPTVSSELLHLVDSAIMGRPESLEKLKNI
VSEAESFRSREDVDCSPFLVVDSLIATMGGIESFEEDDENSPPSVMLNSRAAVVAGELIP
WLPWEGDSDIVMSARTRMVRGLLVILRACARNRAMCSMAGLLGVLLRSAENIFTQDVGSI
KQIKWDGTPLCYCIQHLAGHSLSVIDLHGWFQVMTRTITTIWAPHLMLALEKAVCGKESR
GPACTFEFFGECSGLLASGDSRWPFTNGYAFSTWIYIESFADSLNTATAAAAIAAAAAAE
SGKSSAMSAAAAASALAGEGTALMPRLFSFLSTDNQGIEAYFHAQFLVVESGNGKGKKAS
VHFTHPFKPQCWYFIGLEHVCRQGLIGKAENELRLYIDGSLYESRPFEFPRISKPLAFCC
IGTSPPPTTASLQNSQPQCPLFAEMGPVYIFKEPIGPERMARMASRGGDMLPSFGNGAGL
PWLATNDHVQRMAEESSLLDAEIGSCLYVLYHPCLLSGRFCPDASPSGAAGIARRPAEVI
GQVHIATRMRAVEAIWALAYGGPMSLLPLAISNVHQDSLEPEKGSPPLSLATASLAAPIF
RIISVAINHPGNNEEIYRRKGPEILSRILNYLLQTLSSLGAGKDDGARDEELVASVVSIC
LFQKHNYALKVQLFSTLLLDLKIWRLCSYGLQKKLLSSLADMVFTESSVMRDANAMQMLL
DGCRRCYWTIREKDSLDSVSLNGDMRPMGEVNALVDELLVVIELLIGAAPPSMAADDVCC
LLGFMVDCPQSNQVARVLHLIHRLVVQPNATRAQTFAEAFIGSGGIETLLVLLQREAKAG
DHHIPETNTKADESSSVQRSEPGDSGGGVPGQSQNEGSLKERDQTSEKKDFESQPLGCGV
FSPSTKVERISSVSENTFMKNLGGISLSISADNARNNVYNFDKNDGIVVGIIGLLGALVA
RGHLKFGSPVSSEMTSSLFGAELNDAGGGMFEDKVSLLLFALQKALQAAPNRLMTTNVYM
ALLGASINASSTEDGLNLYDSSNHFEHLQLLLVLLRVLPHAPRAFQSRALQDLLFLACSH
PENRSRLTKMEEWPEWILEVHISNYEMDARKQSCSVNLGDIEDLIHNFLIIMLEHSMRQK
DGWKDIEATIHCAEWLSIVGGSSTRDKRIRREESLPIFKRRLLGGLMDFATRELQAQTQL
IAAASAGVAAEGLSAKDAKLEAQNAAQLSVFLVENAIVILMLIEDHFRLQSKISNASRKV
DGNASPVHIASSLNNHSNSTVSISRESSEAEDDDISVDSGGLPFDISATAMERLTAAAAA
EPYDSVSAAFVSYGSCATDIAEGWKYRSRLWYGLGLSEKEVGIGGGGSGWELWNAALKKD
ANGNWIELSLVKKSVNMLQALLLDDSGLGDCLGMGGGSGTGMGGMAALYQLLDSDQPFLC
MLRMVLLSMREEDTGQDNMLTRNVGIEDGMSEGVNHQGGNNMSLDDSAQIAVGKPWSSLV
WSVLSPILNMPISDSKRQRVLVASSVLYSEVWHAVGRDRKPLRKQYLEAIVPPFVAVLRR
WRPVLAGIHDLATPDGLNPLTVDNRILAADAPPLEAALAMVSPAWAAAFASPPAAMGLAM
IAAGASGAETPAPPTTAHLKRDSSMLERKTAKLTTFSSFQKPLEVPTKTPSHPKDKAAAK
AAALAAARDLERNAKIGSGRGLSAVAMATSAQRRNASDMERVKRWNDSEAMGVAWMECLQ
PFDTKSVYGKDFNALSYKFIAVLVASFALARNIHRSETDRRGQVDLVAQYRLFTGIRAWR
KLIHYLIEMKCLFGPLGDQFSSQAHIFWKLEFTESSSRMRPCLRRNYIGTDHIGATSSFE
DQNDVKKNQENVISSSNAAIIAAEAISMELVNEDEQPEIDNLDNGTYKNGQNGEDPPRLS
RITEQPLQKSIESAYTKLASVQDLVQSSSAIAPGYVPSEHDDRIVFELPSSMVQQLKVMQ
GTFQVTTTRINFIVDNTESSIGPDGSEGNSEVRNNKKDRCWLMTSLHQIYSRRYLLRRSA
LELFLIDRSNFFFDFGSSDDRRNAYRAIVQARPPHLNNSYLATQRPEQLLKKTQLMERWA
RWEISNFEYLMRLNTLAGRTYNDITQYPVFPWILSDYNSKSLDLADPSAFRDLSKPIGAL
NPDRLKKFQERYASFDDSVIPKFHYSSHYSSAGTVLYYLVRVEPFTSLSIQMQGRNFGQA
DRVFSDVAATWKGVLEDMSDVKELVPELFYLPEMLTNEKSIGFGTTQSGGKLGSVKLPPW
AENPVDFIRKHRMALESEHVSAHLHEWVDLIFGYKQRGKEAISANNTFSYITYEGTVNID
KISDPVKQHAIQDQIAYFGQTPSQLLTVPHMKKMPLSKALHLQTIFRNPKEVKPYAVLVP
ERCNLPAAAIHASEDAVIIVDRNVPAARIARHKWQPNTPDDQGKPFVFQHGQATASSASG
ALTRMFKAPGGSGSDECQFPQALAFASSGIRSSSIVSITCDKEIITGGHADNSIKILSPD
GANTLETAFGHCAPVTCLSLSPDSNYLVTGSRDSTVLLWRIYRASTSGSNSTPEPPASPR
RPPSPARANLAKIIADKSRQHWIEGPIHVLRGHHKEILCCCVSTDLGLVVSCGLSSDVLL
HSIRRGRLIRRLAGVEADAVCLSSEGIILTWNQSKRTLSTFTLNGVLVARAQLPSLGGVG
CMEISMDGKSALIGMNSTLRNNSRDSSLKKAVVDDSALESEENKSNKLDIPSPSICFLDL
HTLKVFHVLKLKEGQDITALALNEDNTNLLVSTADKQLIVFTDPALSKKSGGSAA
Download sequence
Identical sequences A0A0D2S051
XP_012475132.1.20347 Gorai.004G155500.2|PACid:26771935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]