SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.004G155500.3|PACid:26771934 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.004G155500.3|PACid:26771934
Domain Number 1 Region: 2085-2374
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-120
Family BEACH domain 0.0000000169
Further Details:      
 
Domain Number 2 Region: 2498-2566,2605-2719,2755-2802
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.53e-28
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 3 Region: 1963-2073
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-22
Family PreBEACH PH-like domain 0.0025
Further Details:      
 
Weak hits

Sequence:  Gorai.004G155500.3|PACid:26771934
Domain Number - Region: 326-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000348
Family Clostridium neurotoxins, the second last domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.004G155500.3|PACid:26771934
Sequence length 2816
Sequence
MENDYSSTSELRHDSDYSSLGSPIKPKPKADMPTVSSELLHLVDSAIMGRPESLEKLKNI
VSEAESFRSREDVDCSPFLVVDSLIATMGGIESFEEDDENSPPSVMLNSRAAVVAGELIP
WLPWEGDSDIVMSARTRMVRGLLVILRACARNRAMCSMAGLLGVLLRSAENIFTQDVGSI
KQIKWDGTPLCYCIQHLAGHSLSVIDLHGWFQVMTRTITTIWAPHLMLALEKAVCGKESR
GPACTFEFFGECSGLLASGDSRWPFTNGYAFSTWIYIESFADSLNTATAAAAIAAAAAAE
SGKSSAMSAAAAASALAGEGTALMPRLFSFLSTDNQGIEAYFHAQFLVVESGNGKGKKAS
VHFTHPFKPQCWYFIGLEHVCRQGLIGKAENELRLYIDGSLYESRPFEFPRISKPLAFCC
IGTSPPPTTASLQNSQPQCPLFAEMGPVYIFKEPIGPERMARMASRGGDMLPSFGNGAGL
PWLATNDHVQRMAEESSLLDAEIGSCLYVLYHPCLLSGRFCPDASPSGAAGIARRPAEVI
GQVHIATRMRAVEAIWALAYGGPMSLLPLAISNVHQDSLEPEKGSPPLSLATASLAAPIF
RIISVAINHPGNNEEIYRRKGPEILSRILNYLLQTLSSLGAGKDDGARDEELVASVVSIC
LFQKHNYALKVQLFSTLLLDLKIWRLCSYGLQKKLLSSLADMVFTESSVMRDANAMQMLL
DGCRRCYWTIREKDSLDSVSLNGDMRPMGEVNALVDELLVVIELLIGAAPPSMAADDVCC
LLGFMVDCPQSNQVARVLHLIHRLVVQPNATRAQTFAEAFIGSGGIETLLVLLQREAKAG
DHHIPETNTKADESSSVQRSEPGDSGGGVPGQSQNEGSLKERDQTSEKKDFESQPLGCGV
FSPSTKVERISSVSENTFMKNLGGISLSISADNARNNVYNFDKNDGIVVGIIGLLGALVA
RGHLKFGSPVSSEMTSSLFGAELNDAGGGMFEDKVSLLLFALQKALQAAPNRLMTTNVYM
ALLGASINASSTEDGLNLYDSSNHFEHLQLLLVLLRVLPHAPRAFQSRALQDLLFLACSH
PENRSRLTKMEEWPEWILEVHISNYEMDARKQSCSVNLGDIEDLIHNFLIIMLEHSMRQK
DGWKDIEATIHCAEWLSIVGGSSTRDKRIRREESLPIFKRRLLGGLMDFATRELQAQQTQ
LIAAASAGVAAEGLSAKDAKLEAQNAAQLSVFLVENAIVILMLIEDHFRLQSKISNASRK
VDGNASPVHIASSLNNHSNSTVSISRESSEAEDDDISVDSGGLPFDISATAMERLTAAAA
AEPYDSVSAAFVSYGSCATDIAEGWKYRSRLWYGLGLSEKEVGIGGGGSGWELWNAALKK
DANGNWIELSLVKKSVNMLQALLLDDSGLGDCLGMGGGSGTGMGGMAALYQLLDSDQPFL
CMLRMVLLSMREEDTGQDNMLTRNVGIEDGMSEGVNHQGGNNMSLDDSAQIAVGKPWSSL
VWSVLSPILNMPISDSKRQRVLVASSVLYSEVWHAVGRDRKPLRKQYLEAIVPPFVAVLR
RWRPVLAGIHDLATPDGLNPLTVDNRILAADAPPLEAALAMVSPAWAAAFASPPAAMGLA
MIAAGASGAETPAPPTTAHLKRDSSMLERKTAKLTTFSSFQKPLEVPTKTPSHPKDKAAA
KAAALAAARDLERNAKIGSGRGLSAVAMATSAQRRNASDMERVKRWNDSEAMGVAWMECL
QPFDTKSVYGKDFNALSYKFIAVLVASFALARNIHRSETDRRGQVDLVAQYRLFTGIRAW
RKLIHYLIEMKCLFGPLGDQFSSQAHIFWKLEFTESSSRMRPCLRRNYIGTDHIGATSSF
EDQNDVKKNQENVISSSNAAIIAAEAISMELVNEDEQPEIDNLDNGTYKNGQNGEDPPRL
SRITEQPLQKSIESAYTKLASVQDLVQSSSAIAPGYVPSEHDDRIVFELPSSMVQQLKVM
QGTFQVTTTRINFIVDNTESSIGPDGSEGNSEVRNNKKDRCWLMTSLHQIYSRRYLLRRS
ALELFLIDRSNFFFDFGSSDDRRNAYRAIVQARPPHLNNSYLATQRPEQLLKKTQLMERW
ARWEISNFEYLMRLNTLAGRTYNDITQYPVFPWILSDYNSKSLDLADPSAFRDLSKPIGA
LNPDRLKKFQERYASFDDSVIPKFHYSSHYSSAGTVLYYLVRVEPFTSLSIQMQGRNFGQ
ADRVFSDVAATWKGVLEDMSDVKELVPELFYLPEMLTNEKSIGFGTTQSGGKLGSVKLPP
WAENPVDFIRKHRMALESEHVSAHLHEWVDLIFGYKQRGKEAISANNTFSYITYEGTVNI
DKISDPVKQHAIQDQIAYFGQTPSQLLTVPHMKKMPLSKALHLQTIFRNPKEVKPYAVLV
PERCNLPAAAIHASEDAVIIVDRNVPAARIARHKWQPNTPDDQGKPFVFQHGQATASSAS
GALTRMFKAPGGSGSDECQFPQALAFASSGIRSSSIVSITCDKEIITGGHADNSIKILSP
DGANTLETAFGHCAPVTCLSLSPDSNYLVTGSRDSTVLLWRIYRASTSGSNSTPEPPASP
RRPPSPARANLAKIIADKSRQHWIEGPIHVLRGHHKEILCCCVSTDLGLVVSCGLSSDVL
LHSIRRGRLIRRLAGVEADAVCLSSEGIILTWNQSKRTLSTFTLNGVLVARAQLPSLGGV
GCMEISMDGKSALIGMNSTLRNNSRDSSLKKAVVDDSALESEENKSNKLDIPSPSICFLD
LHTLKVFHVLKLKEGQDITALALNEDNTNLLVSTADKQLIVFTDPALSKKSGGSAA
Download sequence
Identical sequences A0A0D2PCH7
Gorai.004G155500.3|PACid:26771934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]