SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.005G075600.1|PACid:26803996 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.005G075600.1|PACid:26803996
Domain Number 1 Region: 480-770
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-73
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 84-196
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.01e-17
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  Gorai.005G075600.1|PACid:26803996
Domain Number - Region: 159-261
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0108
Family alpha-D-mannose-specific plant lectins 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.005G075600.1|PACid:26803996
Sequence length 852
Sequence
MSKFSLILLYLNFLFTISSSSTLIPLGSTLQASNRNQSWSSPNTSFSLSFIPVTPSSFVA
AITYNAGDVIVWSASDGSNGTGDGASLVVNSGGTLNLLSNGALRLTNGSGAIVWDSATAN
RGVSHASLDDLGNFQLLNNESVPIWSSFQNPTDTLVPSQNFTVGMILRSGSYSLTLDRSA
NLTLNWNDTIEYWSLGFNSSINGNLTSPRFMLQSNGILVGLDPSFARGVINMAFTTDYGE
SNDVFRFLRMDNDGNLRIYSSSTGNNGSGNITQTWAAVTDQCQVYGFCGNMGICSYKDSK
PVCGCASQNFEPVNEHDGRKGCKRKVEIEDCPGDVTMLQLEHTMFLTYPPDLSDQLVTLA
IVACRTNCLASSTCTASTLVADGSGFCYLKTPDFVSGYQGAVLPSTSFIKVCGQAIPNPS
PYQEASAKDNDSLHTMVIVSVVMASLLALVVVGIGFWCLLYSNRNKSGRMSVQYELVDYA
SGAPVKFSYKELQQSTKGFSERLGEGGFGAVYKGTLANRMVVAVKQLEGIEQGERQFRME
VATISSTHHLNLVRLVGFCCEGRHRLLVYEFLKNGSLDKFLFTSKDQSGKSLKWENRFNI
ALGTARGITYLHEECRDCIIHCDIKPENILLDEAYTAKVSDFGLARLMNPKDHRHLSLAS
IRGTRGYLAPEWLANHPITSKCDVYSYGMVLLEIVSGRRNFEVSPETDGKKFSLWAYSEF
EKGHIEAIVDKRTKDVDSEEVERAIMVSFWCIQEQPSRRPMMGKVVQMLEGVIDIDSPPA
PKPAVEGSSRGTAITVNSNVSGLSTYAASNPAPSSSSSFMNIGASPPTPEREMGKESSSL
LGLKLSETDPDS
Download sequence
Identical sequences A0A0D2N906
Gorai.005G075600.1|PACid:26803996 XP_012482355.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]