SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.005G110900.1|PACid:26803706 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.005G110900.1|PACid:26803706
Domain Number 1 Region: 734-1080,1183-1225
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.96e-72
Family FAD-linked reductases, N-terminal domain 0.0000321
Further Details:      
 
Domain Number 2 Region: 1062-1173
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.35e-28
Family L-aminoacid/polyamine oxidase 0.00036
Further Details:      
 
Domain Number 3 Region: 485-579
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000034
Family SWIRM domain 0.027
Further Details:      
 
Domain Number 4 Region: 1321-1405
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000157
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.005G110900.1|PACid:26803706
Sequence length 1760
Sequence
MDGGGGSKKRLKVTAAEVGVDSDDDEPILSLLKLRRPKNPKKDKAGLEGSAGKFQKVEVK
AGKTVDKDEEDFGGMNDTLASFRKKLKDPKKDIDPGAMRVRSNSLNKSVEGGGILDGKSV
SNTDVKGQDIGEDRSDVATDKVVGKKRTGKVRRTKSDSKTKPSEVDDESRAKLEEDQNEG
GLSPGEGLYQCSHKAQSASVGKSCPILCLKHNCEAAHHASDSKNPSRNCGDSSHSVSSSS
FSHSSSKECNTAENQGFDHSLYQQESILEPGDLTVEKDPTEHPCRSSKVCDKDCHSNIEL
RDNFSAIDLRSKPGTESSQQNKLNLSLSVVDSLKMEETCTDVPNSCAEEYSLETSIHPNE
LVASIQRCNSALHQPSEDASHGACGPTHDTVFISKKANVDSPISTPDENESCHEDAVSLP
SSELKNSKSSAFQRGGRNIKKRRHGDMAYEGDADWENLLTEQGFFGNQQFADSDHSFRAR
EKFDEAAVSSGLKACAVGPVEKIKFKEVLKCRGGLQEYLECRNHILGLWSKDVNRILPLV
DCGVSDTPSEGEPSRASLIREIYAFLDQGGYINFGISSKKEKAELSVKDNYKLLEGRKSD
GNSVASVADSEDGVAFILGQVKNSKASMDAKTGLRVVDENQASEATIAIAEVLVDSITPE
LPYKCQQNGSFSAKLNTGLISSQVSSSDLSCDATDVGVAPVVTPEERNDSQYVQSATYDK
PDGNHQLLNDSEVRKNIIVIGAGPAGLTAARHLKRQGFSVVVLEARDRIGGRVYTDCSSL
SVPVDLGASIITGVEADVSTNRRPDPSSLICAQLGLELTVLNSSCPLYDIVSGQKVPADL
DDALEAEYNSLLDDMVFLVAQKGKKAMTMSLEDGLEYALKRHRMEEIGADIEETESHSSV
DAFYDSKASNIFGFPRKKCSEEEILSPLERRVMNWHYAHLEYGCAASLKEVSLPNWNQDD
VYGGFGGAHCMIKGGYSTVVESLGEGLLIHLNHVVTNISYSPKGPGVDNSHHRQVKVSTS
NGSEFSGDAVLITVPLGCLKAGAIKFSPPLPQWKHSSIQQLGFGVLNKVVLEFPEVFWDD
TVDYFGVTAEETDSRGHCFMFWNVRKTVGAPVLIALVAGKAAIDGQNMSASDHVNHAVII
LRKLFGEASVPDPVASVVTDWGRDPFSYGAYSYVAIGASGEDYDMLARPVENCLFFAGEA
TCKEHPDTVGGAMLSGLREAVRLIDIFTTGNDYTAEVEAMEAAQRHSESGRDEVRDIIKR
LEAVELSNVLYKNSLDRARILSREALLRDMFFNVKTTAGRLHLAKKLLGLPVESLKSFAG
TKEGLSTLNSWMLDSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSR
DIRAIASQLVNVWLEVFRKAKASSKRKSLKDPASGKPPLHSQHGAFESKESLQDPFSAGK
QYPLNIKENGKSLDIEVEAVNQGMSEEEQAAFAAEAAARAAAKAAAEALASTEANCNKLL
QLPKIPSFHKFARREQYAQMDEGKWPGGVFGRQDCISEIDSRNCRVRDWSVDFSAACVNL
DNSGMSVDNLSQRSHLKLREHSGESLAVDSSIFMKAWVDTAGNGGIKDYHAIERWQSQAA
AADPDFFHPTNFKDEEDSNTSSRQPTWKNDGRANESSVSQVSVNKERFENHPHGADRIKQ
AVVDYVASLLMPLYKARKIDKEGYKSIMKKTATKVMEQATDAEKNMAVFEFLDFKRKNKI
RPFVDKLIERHMAMKPTMKL
Download sequence
Identical sequences A0A0D2SEI6
Gorai.005G110900.1|PACid:26803706 Gorai.005G110900.2|PACid:26803707 Gorai.005G110900.3|PACid:26803705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]