SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G013100.2|PACid:26817674 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G013100.2|PACid:26817674
Domain Number 1 Region: 115-307
Classification Level Classification E-value
Superfamily Sec7 domain 6.41e-77
Family Sec7 domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 577-901,930-1022,1064-1192,1240-1279
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000000019
Family Armadillo repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G013100.2|PACid:26817674
Sequence length 1286
Sequence
MTAMSIHQTYLKDICRIVNGLLKTALGPPSGSTTTLSAVQDVTFRHESVKCLVGIIKSMG
AWMDGQLKIGHSDSPKSFENDTLAESHSTSTAEDGTLADCELHPEMNSELSDAATVEQRR
AYKIELLKGVSLFNRKPSKGIEFLINTRKVGNTPEEVASFLKKNTTGLNETMIGDYLGER
EEFALKVMHAYVDSFNFKSMDFGEAIRFFLRGFRLPGEAQKIDRIMEKFAERYCKCNPNS
FTSADTAYVLAYSVIMLNTDAHNNMVKDKMTKSDFIRNNRGINDGKDLPEEYLGALYDQI
VKNEIKMNADSSVPQSKQENSLNKLLGLDGILNLVSWKQTEDKPLGANGLLIRHIQEQFK
AKSGKSESVYHVVSDVSILRFMVEVCWGPMLAAFSVTLDQSDDRLATTHCLLGFRHAVHV
TAVLGMQTQRDAFVTSVAKFTFLHCAADMKQKNVDAVKAIITIAIEDGNHLQEAWEHILT
CLSRIEHLQLLGEGAPTDASFLSVSNTETDEKMAKSAGLQSLKNKGTLQNLAVMAVVRGG
SYDSASVGVNNSGLVSPEQINHFIANLNLLEQIGSFELNHVFAHSQRLNSEAIVAFVKAL
CKVSISELQSPTDPRVFSLTKLVEIAHYNMNRIRLVWSRMWNVLSDFFVSVGLSENLSVA
IFVMDSLRQLAMKFLEREELANYNFQNEFLRPFVIIMWKSNSTEIRELIVRCISQMVLSR
VRNVKSGWKSVFSVFTAAAADEHKNVVLLAFETMEKIVREYFPYITETEAATFTDCVRCL
IKFTNSRFNSDVSLNAIAFLRFCAFKLAEGGLVCTDKSSDDGSSVSTVIKDDSGVQSFTD
IDDPGSYWGPLLTGLSKLTSDSRLAIRKSSLEVLFNILNDHGHLFSQTFWLGVFSSVVLP
IFDGVCEKRDKALQTEQDSPTAESPHRDAITWDTETSAVALQCLVDLFISFYDVLRPRLS
DVVCILTRYLRSSIQGPASTGVAALSHLTGELGSRLSEDEWQEILLALKEAAMSTLPGFK
KLLTTMDDIKVPHNSQSYSNTETSSDHGLTNDDLEDDNLQNVAYVVSRTKSHISVQLLIL
EVVTDMYRTHLQFLSAANINIIVEIFSSISSHALQLNSETTMQKKIQIACSILELSEPPM
IHFEKEAYQNYLDFLQYLVKKNLSISKEMNLELLLVAVCEKIMQIYLNCTTVNHNVQQKS
GDKVVVVTHWTLPLSSAKKEELAARTPLLVSALRALSGLERDSFRKYISNVFLLLVDLVQ
SEHSSGEVQRVLSNIFQSCIGTIIMQ
Download sequence
Identical sequences A0A0D2R6X7
Gorai.008G013100.2|PACid:26817674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]