SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G066900.4|PACid:26818375 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G066900.4|PACid:26818375
Domain Number 1 Region: 31-210
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.75e-66
Family Inorganic pyrophosphatase 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G066900.4|PACid:26818375
Sequence length 215
Sequence
MANNGGEATSGKSAGFSRVALNERILSSMTRRSIAAHPWHDLEIGPGAPAVFNCVVEIGK
GSKVKYELDKTSGLIKVDRVLYSSVVYPHNYGFIPRTICEDSDPMDVLILMQEPVLPGSF
LRARAIGLMPMIDQGEKDDKIIAVCADDPEFRHYTDIKQLPPHRLAEIRRFFEDYKKNEN
KKVDVEDFLPAETAIEAIKYSMDLYASYIVESLRK
Download sequence
Identical sequences A0A0D2RAK5
XP_012436870.1.20347 XP_012436871.1.20347 Gorai.008G066900.3|PACid:26818374 Gorai.008G066900.4|PACid:26818375 Gorai.008G066900.7|PACid:26818376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]