SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.008G120700.1|PACid:26814602 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.008G120700.1|PACid:26814602
Domain Number 1 Region: 498-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.32e-72
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 85-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.41e-25
Family alpha-D-mannose-specific plant lectins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.008G120700.1|PACid:26814602
Sequence length 860
Sequence
MSSLSFIFFLLLLSFHTQNAIFVTNSSPNDPSSKPPLLNEETLKTSSQATKMESTVVILK
GNATVLSVNRTFELGFFTINGESDWYLGIWYSSIPTQTRVWVANREKPIKNITGSSLEIT
GTGRLVVKESPDSVVWQSDNVEKAKRFVFLETGNLVLYSSNGLKVWQSFDFPTDTWLPGM
NLTAQQALTSWKSSFDPSPGLFSLRLNPQLFNEFELVHNLINVYWSTGNWTGKAFVDVPQ
MTIPYIYNFRFSDPYLPTASFGYTERSLDGSVEPPLTRFQVDVNGQLKQYTWSAETESWN
MFWSVPEDKCGVYGLCGDFGSCLVSTTLKPCACVNGFRPFNEKEWGYGDFTGGCRRESGC
LCADNDGFNEIGDVRFDGGKTVSFQGTRSICEKSCLSNCSCIGLYHNEGSNTCNNVYGSL
LNLRNSSSNGLKKDVFYIRVPRGIMKKNVHRTMVFVGSIVGSIVALGFMAMIFLVFKKII
DYKRKDRYDDDGVCPGLNLKVFTYKELNGVTRGFSEKLGHGGFGVVFRGELSDSTLVAVK
RLERPGSGEKEFRAEVCTIGNIQHVNLVRLRGFCSENSHRLLVYDYMPNGPLSAFLIPDS
PNLCWDVRFRVAVGTAKGIAYLHEECRDCIIHCDIKPENILLDSDYIAKVSDFGLAKLVG
RDFSRVLATMRGTWGYVAPEWISGMAITPKADVYSYGMTLLEIIGGRRNVQAPQSAGNGN
AFNEGRDGEKWFFPPWAARRIIEGNVAAIVDSRLGVAYNLEEANRLALVAVWCIQDDEEM
RPTMGMVVKMLEGVVEVTIPPPPKLIQAIVAGESYHGIGTNSGMSKVNGCSDYNVGFSSA
GSRSSLSNLSSPLEPKFGEV
Download sequence
Identical sequences A0A0D2SZD9
XP_012437699.1.20347 Gorai.008G120700.1|PACid:26814602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]