SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.009G020200.1|PACid:26764134 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G020200.1|PACid:26764134
Domain Number 1 Region: 165-267
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.46e-25
Family B3 DNA binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 43-101
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000654
Family GCC-box binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G020200.1|PACid:26764134
Sequence length 348
Sequence
MEEEILSVISSGGGNTNSDVSNSISTTHQANKRQRCGDKGNSSQFKGVMRQKNGKWGAQL
YSNHTRIWLGTFKTEIDAAVAYDSATIKFCPGDTHRNFPWNEITIEEPKFLSHYSAEAVL
SMIRDGSYQFKFMDFIKACSRSTKPNTAIKSVGTYSNEGLICKQLFQKKLTPSDVGKLNR
LVIPKRYAVKYFPSIFWTEKENADVADSKTNDVELVFYDKFMRIWKFRYCYRNSSQSFVF
TRGWNRFLKEKKLKANDVVSFFVCECRKENEVQRFCMIDANKSGNGGTFVAVNNIHVGIE
VDLQLRLGHYYPIGDEKHVQEEQGSMAAAKPKQDDKTEGFKLFGMQIN
Download sequence
Identical sequences A0A0D2UET7
XP_012442726.1.20347 Gorai.009G020200.1|PACid:26764134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]