SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.009G058300.3|PACid:26769600 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G058300.3|PACid:26769600
Domain Number 1 Region: 469-762
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-79
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 83-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.94e-25
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  Gorai.009G058300.3|PACid:26769600
Domain Number - Region: 356-390
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0549
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G058300.3|PACid:26769600
Sequence length 827
Sequence
MESGDFIRFLGFFALSSLFLSEICTASIRSTGSIDPGFQGTQMNWIDNNGLFLVSNNSAF
GFGFTTTSDVTLFLLVVVHIDTTKVIWTANRGSPVSNSDPFVFDKNGNVLLQKGGNVVWT
TNTSGKGVSAMVLQDSGNLVLQGDDGKVMWQSFAHPTDTLISDQEFRQGMKLISDPSSTN
VSYILEIKSGDMILSAGYSTPQPYWSMGKDTRKNINKNGGEVTLATIDTNSWSLFDESKV
LLWQFKISDPNDANATWIAVLGNDGVISFFNLHAGRAASSIKIPDDPCGTPEVCQPYFVC
SAPSDRTKCQCPSALGSGSCKTGIISPCGERKESVSLVDAGTGLNYFALDYVSPSSKTNM
DGCKASCMSNCSCMVAFYDNSSRNCFLFDQVGSFQNSNQPSNLVAFVKMSSNANGVGNGG
GNKSFPYVAIIVVSTVLVILGLLFVSYRYYKKKKKVPGSPDDSSEEDIFLESLTGMPTRF
TYNDLRVATNSFSVKLGHGGFGSVYRGILADGTQIAVKKLESIGQGKKEFRAEVGIIGSI
HHVHLVRLKGFCAEGSYRLLAYEYMANGSLDKWIFKRNREEEPLLDWRTRFNIAVGTAKG
LAYLHEDCDAKIVHCDIKPENVLLDDHFLAKVSDFGLAKLMTREQSHVFTTLRGTRGYLA
PEWITNYAISEKSDVYSYGMLLLEIIGGRKNFDPGESSEKSYFPSYAFKMLDEGKLRDIL
DSRLNLEGEDERVYTAIKVALWCIQEDMHLRPSMTKVVQMLEGLSPVTKPPMSSPLGSRL
YSSFFKSMTTSGEGTSSASASASASASGPSDCNSDAYLSAVRLSGPR
Download sequence
Identical sequences A0A0D2QA06
XP_012442354.1.20347 XP_012442355.1.20347 XP_012442356.1.20347 Gorai.009G058300.1|PACid:26769601 Gorai.009G058300.3|PACid:26769600 Gorai.009G058300.5|PACid:26769602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]