SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.009G058300.4|PACid:26769603 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.009G058300.4|PACid:26769603
Domain Number 1 Region: 427-720
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-79
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 41-166
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.41e-25
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  Gorai.009G058300.4|PACid:26769603
Domain Number - Region: 314-348
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G058300.4|PACid:26769603
Sequence length 785
Sequence
MNWIDNNGLFLVSNNSAFGFGFTTTSDVTLFLLVVVHIDTTKVIWTANRGSPVSNSDPFV
FDKNGNVLLQKGGNVVWTTNTSGKGVSAMVLQDSGNLVLQGDDGKVMWQSFAHPTDTLIS
DQEFRQGMKLISDPSSTNVSYILEIKSGDMILSAGYSTPQPYWSMGKDTRKNINKNGGEV
TLATIDTNSWSLFDESKVLLWQFKISDPNDANATWIAVLGNDGVISFFNLHAGRAASSIK
IPDDPCGTPEVCQPYFVCSAPSDRTKCQCPSALGSGSCKTGIISPCGERKESVSLVDAGT
GLNYFALDYVSPSSKTNMDGCKASCMSNCSCMVAFYDNSSRNCFLFDQVGSFQNSNQPSN
LVAFVKMSSNANGVGNGGGNKSFPYVAIIVVSTVLVILGLLFVSYRYYKKKKKVPGSPDD
SSEEDIFLESLTGMPTRFTYNDLRVATNSFSVKLGHGGFGSVYRGILADGTQIAVKKLES
IGQGKKEFRAEVGIIGSIHHVHLVRLKGFCAEGSYRLLAYEYMANGSLDKWIFKRNREEE
PLLDWRTRFNIAVGTAKGLAYLHEDCDAKIVHCDIKPENVLLDDHFLAKVSDFGLAKLMT
REQSHVFTTLRGTRGYLAPEWITNYAISEKSDVYSYGMLLLEIIGGRKNFDPGESSEKSY
FPSYAFKMLDEGKLRDILDSRLNLEGEDERVYTAIKVALWCIQEDMHLRPSMTKVVQMLE
GLSPVTKPPMSSPLGSRLYSSFFKSMTTSGEGTSSASASASASASGPSDCNSDAYLSAVR
LSGPR
Download sequence
Identical sequences A0A0D2TKF7
Gorai.009G058300.4|PACid:26769603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]