SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.009G237000.2|PACid:26762731 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Gorai.009G237000.2|PACid:26762731
Domain Number - Region: 239-277
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0235
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Gorai.009G237000.2|PACid:26762731
Sequence length 423
Sequence
MSPSGDGAINGGCCCSCSPGENGGYDGATNFGISASHDETCMHCPRSEPSSCSSSELGFD
PVLLTDSERLRRIFVASAKGFSIGAGLQGGLAIFSILARLRRKKPKKVEAFSDKEAISMA
IKETLRYGIFLGTFAGTFVYVDETVAACGGNHRTAKWRALVAGLVAGPSMLLTGSNTRHT
SLAIYILMQAAVLASRCGIKSKRFGKFCKPLTWKHGDIFLMCLSTSEILSSYILKQDCLP
PSYKSFLNQHGGKDIVILQGVKELASDLPFTTLEAIEKIYKATGVDVKLDPNMKIPCSMV
HGNKSCRAHAITFLIEAYKRALPVYLPVYLIPALIVHHQGLFKRPCTILGKGIVDIARSS
LFLATYCTSAWMWTCMLFGFLRRCSIPLIAIGSVKDSFNLSYLEYPCSTYIQTSMTRQIH
SKA
Download sequence
Identical sequences A0A0D2S755
Gorai.009G237000.2|PACid:26762731 XP_012446368.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]