SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.010G048500.1|PACid:26758954 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.010G048500.1|PACid:26758954
Domain Number 1 Region: 686-996
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-76
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 1128-1263
Classification Level Classification E-value
Superfamily Lysozyme-like 8.44e-37
Family PBP transglycosylase domain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 265-395
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000157
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Domain Number 4 Region: 112-173
Classification Level Classification E-value
Superfamily Lysozyme-like 0.00000000000000219
Family PBP transglycosylase domain-like 0.0012
Further Details:      
 
Weak hits

Sequence:  Gorai.010G048500.1|PACid:26758954
Domain Number - Region: 560-600
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.029
Family Pan module (APPLE domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.010G048500.1|PACid:26758954
Sequence length 1325
Sequence
MSLAVASPHRSMIHCKTSKFRFKNPQNLFGRTLTFYSLKSPTHFNSLLCLRVHSVRPESP
SIQTHHPIQELLPLLAFSLSLLCFRLLSNVLLPDFALRWQSLVAFSREAEARTKSYPKHL
WQAIVAYEDRRFFTHFGIDPVGIGRAVLSLSARGGGSTITQQVGKVYLVHGNTYLIIIDK
HLARLPSLRSLLILFSISMESFLFFIFGFLFYSSVSAKSFSEFIYPNFSASHFSFIDKDG
AFLFSRNGTFKASIYNPEAQTNFYLCIIHVESNTIIWSANRDSPISSSGKMDLTVNGISI
ADPDGNPKWSTPQLRTTIYALLLTEMGNLVLLDKFNGSLWESFYHPTDTIVIGQQLPVGA
KLSNAVSESNLSTGDYRFMVSASDALLQWHGQTYWILSMDTKAYVNSNYVVEYMEMNKTG
LSLFGHNGSVVVIQLNLAPATFRLAKLDVLGHFTVNSFSGGKWVQEFVGPIDDCQIPASC
GKLGLCTGDSTSKAPTCSCPSDFHPASQNIGGCLPSGSSYSLPTACDSTNNVNESNSSTV
SYLRLGSGIDYFSLLFSQPVRYGVRFPVCQDLCSEDCACLGMFYENSSGSCYVLENDLGS
VILSSTVENDFLGYVKVLVGPISTDSGGDNSFSNEKNEFPIAAIVLLPSIGFFLLAALVF
FWWKRRLRSKGGEIKLGHLNSGSSEDMDAFYIPGLPQKFDYEELEAATDNFKTQIGSGGF
GSVYRGTLPDKTVVAVKKISNPGIQGKKEFCTEIAVIGNIHHVNLVKLRGFCAQGRQRFL
VYEYMNRGSLDRTLFGSGAVLEWQERFDIALGTARGLAYLHRGCEHKIIHCDVKPENILL
HDHFQAKISDFGLSKLLTPEQSSLFTTMRGTRGYLAPEWLTNSAISEKTDVYSFGMVLLE
LVSGRKNCSLKSQSHSIEDTNSGGGNSLSSSVMGLIYFPLLALEMHEQGRYLELADAKLE
GRVTNKEVEKLVRVALCCVHEEPALRPSMATVVGMLEGGLPLGQPRVESLNFLRFYGRRF
TEASMIEEERRQSDFMLFPQANVSHSSTTGSNACLSYISSQQISVSSLNFVMQLYIFLWY
RWDNLWLWLEYGSAVLTTFSSNSLVIFFLAYFKLVVQTWPGGTSSFLLNEKLVKNTFLKN
ERTFWRKILEMVLALALERTMSKQRILSSYVCKIYWGHGINGIESASNFYFGKHPSQLSL
AESAMLAGLIPAPEHRSPLRDRSSGKTFQARVLKRMVKSGFLDIKMALLTVRQPLYVRLR
RPEHADELSDASSFSELGVGVKSNVNEEGTESTLKGTWDWERESKIREVCEEMERWAIKA
QLRSS
Download sequence
Identical sequences A0A0D2U924
Gorai.010G048500.1|PACid:26758954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]