SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.012G046900.1|PACid:26825402 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.012G046900.1|PACid:26825402
Domain Number 1 Region: 786-1127,1230-1272
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.63e-70
Family FAD-linked reductases, N-terminal domain 0.0000455
Further Details:      
 
Domain Number 2 Region: 1109-1220
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.22e-28
Family L-aminoacid/polyamine oxidase 0.00039
Further Details:      
 
Domain Number 3 Region: 529-623
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000269
Family SWIRM domain 0.02
Further Details:      
 
Domain Number 4 Region: 1368-1452
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000418
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.012G046900.1|PACid:26825402
Sequence length 1812
Sequence
MESDDGSNSKAGPQLQFDLGNNVELGLEKVTLQNSLKLRNKKMDGGGGSKKRLKVTAVEV
DVDSDDDEPILSLLKLRKSKNPKKDKAGLEGSAGKCKKVEVKAVKTEGKNEEDLGGMNDT
LASFRKKLKDPKKDVDLGAKRERDYSLNKSVEGGGVLDGKSVLNTGVKGQDIGEDRSDVV
TDTVVERKHRGKVRRAKFDSKSKPIEVDDESRAKLEEDQNEGGLSPESGLNQHSHEAQSD
SVRKSCPISSLKRNCKGSYHASASKNPSRNYGDKSHSDSSSSFSHSSSKECNTAENQGFD
HSVCQQESILEPGDLNVEKGPTEDPCRSPKVCDKEKYGHSNIELRDNCSAVDQRNKPESE
GSRQAKHNLLPSVVDSLKMEETCTDVPNACAEENSLENSVHPNEFVASIQRCNSALRQPS
EDACHGACGPTHDTLFISKEANVDSPTSTPDENESFHEDAVSLPSSEIKDSMSSAVQRGG
RSIKKRRHGDMAYEGDADWENLLNEQGFFGNQQFADSDRSFRAKEKFDEAAVSSGLKARA
VGPVEKIKFKEVLKGRGGLQEYLECRNHILGLWSKDVNRILPLAECGVSDTPSEGEPPRA
SLIREIYAFLDQGGYINFGIASKKEKAELRVKDNHKLLKERKNYGNSVASVADSEDGVAF
ILGQVKNSEASLDAKVGVRVDDENQASEATIPEVLVDSITSELPCGKEQKEHPSDNCQQN
GSISAKLNPLLISSQVPSADLSCDAIDMGIAPVITPEERNDSHYVQSATYDKPDGNHQLQ
GDSEVRKNIIIVGAGPAGLTAARHLKRQGFSVVVLEARDRIGGRVYTDCFSLSVPVDLGA
SIITGVEADVSTNRRPDPSSLICAQLGLELTVLNSSCPLYDIVSGQKVPADLDDALEAEY
NSLLDDMVFLVAQKGQKAMTISLEDGLEYALKRHRMEEIGADIEEIESHSSVDAVYDLKA
SNGKKCSEGEILSPLERRVMNWHYAHLEYGCAAPLKEVSLPNWNQDDVYGGFGGAHCMIK
GGYSKVVESLGEGLLIHLNHVVTNISYGPKDPGIDNSHHRQVKVSTSNGSEFSGDAVLIT
VPLGCLKAEAIKFSPPLPQWKHSSIQQLGFGVLNKVVLEFPEVFWDDTVDYFGVTAEETD
SRGHCFMFWNVQKTVGAPVLIALVAGKAAIDGQTMSSSDHVNHAVLILRKLFGEASVPDP
VASVVTDWGRDPFSYGAYSYVAIGASGEDYDMLGRPVENCLFFAGEATCKEHPDTVGGAM
LSGLREAVRLIDIFTTGNDYTAEVEAMEAAQRRSESGRDEVGDIIKRLEAVELSNVLYKN
SLDRAWVLSREALLRDMFFNVKTTSGRLHLAKKLLGLPVESLKSFAGTKEGLSTLNSWML
DSMGKDGTQLLRHCVRLLVLVSTDLLAVRSSGIGKTVKEKICVHTSRDIRAIASQLVSVW
LEVFRKAKASSKRKSLKDTASGKPPLHSQHGAFESKASLQDPFPAGKQYPFYAKENGKSV
DMEVESVNQGMSEEEQAAFAAEAAARAAAKAAAEALASTEANCNKLLQLPKIPSFHKFAR
REQYAQMDEGKWPGGVFGRQDCISEIDSRNCRVRDWSVDFSAACVNLDSSRMSVDNLSQR
SHLKLREHSGESLAVDSSIFTKAWVDNAGSEGIKDCHAIERWQSQAVAADPDFFHPTNFK
DEEDSNASSRQTTWKHDGRANESSISQVSVNKERFENHPHGTDRIKQAVVDYVASLLMPL
YKARKIDKEGYKSIMKKTATKVMEQATDAEKNMAVSEFLDFKRKNKIRPFVDKLIERHMA
MKPIMKHDGVKD
Download sequence
Identical sequences A0A0D2V1W1
Gorai.012G046900.1|PACid:26825402 Gorai.012G046900.2|PACid:26825401 Gorai.012G046900.3|PACid:26825400 XP_012458971.1.20347 XP_012458972.1.20347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]