SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.012G116800.1|PACid:26825090 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.012G116800.1|PACid:26825090
Domain Number 1 Region: 22-135
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.22e-28
Family Chaperone J-domain 0.00021
Further Details:      
 
Domain Number 2 Region: 181-292
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000382
Family Thioltransferase 0.063
Further Details:      
 
Domain Number 3 Region: 427-550
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000951
Family PDI-like 0.054
Further Details:      
 
Weak hits

Sequence:  Gorai.012G116800.1|PACid:26825090
Domain Number - Region: 333-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0548
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Gorai.012G116800.1|PACid:26825090
Sequence length 559
Sequence
MKTRPPLLFAFLLTLLVLHAEAKSIDPYKVLGVEKSASQREVQKAFHKLSLKYHPDKNKS
KGAQEKFAEINNAYDILSDEEKRKNYDMYGDEKGGPGQSGFTSGPGGWQHMGGDGSSQTF
SFSFGGPSGSRFFGGSSFFGFDYNDIFSSFFGGGMNHQGPFGGFSGSSRSQSQSRNSRKS
IRAISSDVFKKEISDKGMTWLLLSYTPALQQGKQHYESIIDEVAGLLQGAIKVGRINCET
EYSLCKDLGMHPGRALRLFVYSYKRNEKGTLEEYKGDLVAKNVKTFCQDHLPRFSRRLSL
NHLDLSSSNLEKYPRVILLSTKKDTPVIWRALSGLYYRRFSFYDAEVHDVSEPAAKQLGV
DALPAIIGWLPNGERHILKSGISVKDLKSAIKDLSLLLDSFEKKNKKVASSQASKNQKDS
AQRKLPLLTASNSDALCGDKTPVCIIGAFRSSRAREKLESLLSKVSQKSLTRGPNVASGS
RDSVSYIFLDATKQPLFLCAFDKSGYKSSDNILVAFKPRKGKFAAFSGDMTVEEVEKFIS
SVLNGDIQFTKTRQKPVLK
Download sequence
Identical sequences A0A0D2VYE3
XP_012458651.1.20347 Gorai.012G116800.1|PACid:26825090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]