SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Gorai.013G065100.1|PACid:26787014 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G065100.1|PACid:26787014
Domain Number 1 Region: 540-726
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-72
Family Sec7 domain 0.00000246
Further Details:      
 
Domain Number 2 Region: 983-1292,1321-1553
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000448
Family Clathrin adaptor core protein 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G065100.1|PACid:26787014
Sequence length 1647
Sequence
MSASQTLGDPSRCGRVLGPSLDKIIKNAAWRKHSHIVSLCKSTLEKLDTLSDTGLSDPKS
TLLGISLSDADFVLNPILLALDSNYAKVAEPALECTFKLFSLGIVRGEIDSNKSNPILYK
IVESVCKVGGIGEEPVELAVLRVLLSAVQCPCVLIRGDCLLLVVKTCYNVYLGSLSGTIQ
ACDKSVLAQIMLIVFTRAEEDSMDVSIKAVSVNELLEFTDKNLNEGSSLYNCQNFVSEVM
NASEGVPDLKLSQPITLSKGEQNEEVEEEEMKEGAESGSAVVSSKIREDGFHVFKNLGKL
SMKFSSQENPDDQILLKGKTLSLELLKVIMDKGGSIWGTNERQVLFLNVLKQYLCLSLLK
NSALSVMSVFQLQCSIFMSLLTKFRSGLKAEIGILFPMFILRVLENIGGDSQIIIYIFEN
YDCDVDSPNIFERYSFFLIIVNTTSLSAVQDIFLRHESVQCLVSIIKSMGAWMDQQLKIG
DSDLPRSFESDTSSERPSISIVEDGVVPDCELHPEMNFELGLPKYIMIICPITIDFSSVM
YFYKGVSLFNRKPSKGIEFLINTKKVGNSPEEVAAFLKNNTAGLSETVIGDYLGEREEFA
LRVMHAYVDSFNFKSMDFGEAIRFFLCGFRLPGEAQKIDCIMEKFAERYCKCNPDSFTSA
DTAYVLAYSVIMLNTDAHNNMVKEKMTKSDFIQNNRGIDDGKDLPEEYLGALYDQIVKNE
IKMNADSSLPQNKQANSLNKLLGMDGLLNLVNWKQTEEKPLGANGLLIGHIQEQFKAKTG
KSESAYHHISDVAILRFMVEVCWGPMLATFSVTLDQSDDRLATTQCLQGFRYAVHVTAVM
GMQTQRDAFVTSAAKFTFLHCAADMKQKNVDAVKAIISIAIEDGNHLQEAWEHILTCLSR
IEHLQLLGEGAPVDAGVLSVSNSETDEKTSKPVGLQSLKKKGAIQNPAVMAVVRGGSYDS
TTVRINSSGLVPPEQINQFIANLNLLDQIENAELSHVFAHSQRLNSEAIVAFVKALCKVS
MSELQSPTDPRVFSLTKLIEIAHYNMNRIRLVWSRMWHVLSDFFVSVGLSKNLSVASFVM
DSLWHLAMKFLEREELANYNFQNEFLRPFVIIMQKSDSTEIRELIVRCISHMVLSHASNV
KSGWRSVFMVFTAAADYEQKNKATTFMDCIKCLIKFTNSRINSDVSLNAIAFLQFCALKL
AEGGLGCTGKSWDDGSSVSIIYKDDSDVRNIDDHGSCWVPLLTGLSKLTTDSRPVIRKSS
LKVLFNILKDHGHLFSRTFWIGVFSSIVLPIFNDACKRTDMAVKDEQVSPTSKSPHPDGS
TWDTEILEVTARCLISNVVSILIGHLKSPTKGSASTAFAAIFRLTAELGSRFSEDEWRKF
FLALKEAATSTLPELPDNAQYHDNIETSSDDGTKNDDLEDDNLQTVAHVVSRVKSHIAVQ
LLISQVIKDTNKKNLQFLSASNISIIVEIFSSIASHTQQLNTDITLQKKIRIACSIMELT
DPPMVHFENEAYQNYLDFLQDLVQNNPSVSAEMNLESLLVAVCENILQLYLNRTDHHYEQ
QKSGPVTRWVLPLPLAKKEELAARRPLLVLALKALGDLGKDSLRKYIANLFLLLVGLVRI
ENNLGSGEAERVLTNIFQSGIGPIIMQ
Download sequence
Identical sequences A0A0D2VA18
Gorai.013G065100.1|PACid:26787014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]