SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G080000.1|PACid:26787762 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G080000.1|PACid:26787762
Domain Number 1 Region: 174-282
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-30
Family B3 DNA binding domain 0.00000619
Further Details:      
 
Domain Number 2 Region: 48-104
Classification Level Classification E-value
Superfamily DNA-binding domain 5.23e-17
Family GCC-box binding domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G080000.1|PACid:26787762
Sequence length 345
Sequence
MDGSSCIDDSTTSDSMNVSPLSPLCRVGSGNSGVILDTEAESRKLPSSKYKGVVPQPNGR
WGAQIYEKHQRVWLGTFNEEDEAAKAYDIAARRFRGRDAVTNFKQAEKTEGDDMEMAFLE
SRSKAEIVDMLRKHTYNDELEQSRRSYGLDGNGKRVVKYNAGFGPFSFGLGLKPREQLFE
KAVTPSDVGKLNRLVIPKQHAEKHFPLQTGTAFSKEVLLNFEDVRGKVWRFRYSYWNSSQ
SYVLTKGWSRFVKEKNLNAGDIVSFQRSTGPEKQLYIDCKARTGSVSGSANPAVPVPFVR
LFGVNIFNISGGGGDSVGGCNGKRTREMELLELEFSKKQRVIDAL
Download sequence
Identical sequences A0A0D2W3Z8
XP_012465027.1.20347 Gorai.013G080000.1|PACid:26787762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]