SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Gorai.013G249100.1|PACid:26789339 from Gossypium raimondii v221

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Gorai.013G249100.1|PACid:26789339
Domain Number 1 Region: 170-272
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-26
Family B3 DNA binding domain 0.00019
Further Details:      
 
Domain Number 2 Region: 47-103
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000915
Family GCC-box binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Gorai.013G249100.1|PACid:26789339
Sequence length 356
Sequence
MVEDDSSTVLNTKLTVLAAETSDSGNSGYKFRPGKRSRYDQIGSLPKFKGVVPQQNGHWG
AQIYANHQRIWLGTFKSESEAAMAYDSAAVKLRSGDSHRNFPWTEQNIQEPDFQSLYSTE
DVLNMIRDGSYQAKFEDFVKILSKRDGKLNTSNNVNKKLVHGDKQFPCMQLFQKELTPSD
VGKLNRLVIPKKYAVKYFPHICETDRQVSAAGGGVEDIELVFYDKLMVTWKFRYCYWKSS
QSFVFTRGWSRFVKEKKLNEKDTVTFYSCECSGEDQNGKSFFLIDVNYNGENGLGSSAAA
LEEEDRRDDDLAVGLEFNSGSTTKGYSNKAIEGFENGGRNVKQKSVTLFGVQINLL
Download sequence
Identical sequences A0A0D2U6M7
XP_012461694.1.20347 Gorai.013G249100.1|PACid:26789339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]