SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|404493758|ref|YP_006717864.1| from Pelobacter carbinolicus DSM 2380

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404493758|ref|YP_006717864.1|
Domain Number 1 Region: 39-252
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 9.42e-42
Family Phospholipase D 0.027
Further Details:      
 
Domain Number 2 Region: 256-476
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.59e-34
Family Phospholipase D 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404493758|ref|YP_006717864.1|
Sequence length 522
Comment phospholipase D [Pelobacter carbinolicus DSM 2380]
Sequence
MAMRPYLTCLLGLYVSLLSGCTIIDPSVIDRPFTRALHTAADTRLAKQYAPIVAEHAGLS
GFRLIDSGLEALSTRLDLVDQAQKTIDLQYYILRSDLSGLILIDHLLAAADRGVRVRILI
DDLHYEQSGTPLDSLDTHPNVELRIINPFLYRHSLLLGRMFEALWDFSRVQRRMHNKLFV
VDNTVAIIGGRNLGDEYFEVHPRLDLRDIDLLAIGPVVPQLSTSFDSYWNYKQSLPVSAL
TERPADEKPLRDLRQILKKHKQRTDVHAYLQHLADSEVTEVPLTWAKGRLLADFPCKLVP
DQPDCASLDFDRIYGLFQKAESELLIISPYFIPGKQGMGLFRHLRQNGIRVKVLTNSYAA
TDLKIVQAGYNRYRRRLLTEQVDLYEFKPTFPPPFTQRKKRSAFAGASQACMHAKAYVID
RKMVFVGSFNHDPRSATLNSEIGILVESPELAKQLAALFARYTQPQNSYRLQLEPWGKNR
QRLVWQTEEDGKKRTYHQEPLTTWWQHLKNALMAVFAPEDLL
Download sequence
Identical sequences Q3A2Q4
gi|404493758|ref|YP_006717864.1| 338963.Pcar_2113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]