SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400011511 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGSC0003DMP400011511
Domain Number - Region: 2-59
Classification Level Classification E-value
Superfamily WWE domain 0.0204
Family WWE domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400011511
Sequence length 60
Comment PGSC0003DMT400016616
Sequence
MYYQNSQWTDFLENIVSMAKQDLRIKKSATEVVFNDNNYVLDFFHMMLLDLKSGMQQPIV
Download sequence
Identical sequences M1A7Y1
PGSC0003DMP400011511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]