SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400018608 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PGSC0003DMP400018608
Domain Number - Region: 13-109
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0228
Family UbiE/COQ5-like 0.083
Further Details:      
 
Domain Number - Region: 118-154
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0721
Family Protein kinases, catalytic subunit 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400018608
Sequence length 160
Comment PGSC0003DMT400027277
Sequence
MDYRIFNFCRLHQRLIKRGGHLMISTLGSLLDEESSVMYVSPLNLYMLRMADKPTYFFNA
SDLCTASENLSFNIFVIIAMDWWEVGDDILWTWLKRFFEFYSIDLTFYNHIPILRLVVSW
KHSNHIVALKVLFKSQLKQSLVEHQLRREVEILMVTFMTR
Download sequence
Identical sequences M1APG0
PGSC0003DMP400018608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]