SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400020661 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400020661
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.5e-50
Family Pollen allergen PHL P 1 N-terminal domain 0.0085
Further Details:      
 
Domain Number 2 Region: 113-205
Classification Level Classification E-value
Superfamily PHL pollen allergen 1.83e-36
Family PHL pollen allergen 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400020661
Sequence length 208
Comment PGSC0003DMT400030425
Sequence
MGGACGYGNLNSQGYGTNTAALSTSLFNNGLTCGACYQLKCNNNDAKLCLPGTTITVTAT
NFCPPNPSLPNNNGGWCNPPLQHFDLAQPAFLKIAQYKAGIVPISFQRVPCMKKGGIRFT
INGHSYYNLVLVTNVGGAGDVHSVSIKGSKNGWQLMSRNWGQNWQSNAYLNGQSLSFQVT
TSDGRTITSNNAAPSNWQFGQTFEGAQF
Download sequence
Identical sequences M1AU86
PGSC0003DMP400020661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]