SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400034252 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400034252
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-37
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400034252
Sequence length 129
Comment PGSC0003DMT400050752
Sequence
MWLDSWGIVLREQKRALVYDFMPNGSLDKYISTSQEESPRLSWQRKYDIILGVAQGIGYL
HQGCDVRILHFDIKPHNILLDENFIPKISDFGLAKLYPTDNSIVTLTAARGTIGYVAPEL
ISRSIGAIS
Download sequence
Identical sequences M1BQS5
PGSC0003DMP400034252 PGSC0003DMP400034253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]