SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400062421 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400062421
Domain Number 1 Region: 78-278
Classification Level Classification E-value
Superfamily Lysozyme-like 6.19e-70
Family Family 19 glycosidase 0.000000277
Further Details:      
 
Domain Number 2 Region: 25-66
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000000249
Family Hevein-like agglutinin (lectin) domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400062421
Sequence length 279
Comment PGSC0003DMT400090746
Sequence
MRPSKFTTFSLLFSLLLLTAASAQNCGSQAGGALCASGLCCSKFGWCGNTNDHCGSGNCQ
SQCPGGGPGPGPVTGGDLGSVISNSMFDQMLKLRNENSCQGKNNVYTYNAFITAARSFPG
FGTTGDSNTRKREIAAFFAQTSQNTTVSNYVYFDINKHSAGPCTRAIGADLLNNPDLVAT
DPVISFKTSLLFWMTTQSPKPSCHDVIIGRWNPSAGDRAANRLPGFGVIANIINGGLECG
RGNDNMVQDRIGFYRRYCEILGVSPGDNLDCGNQRPFGS
Download sequence
Identical sequences M1DL32
PGSC0003DMP400062421 XP_015160871.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]