SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400017335 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400017335
Domain Number 1 Region: 153-227
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 2 Region: 248-280
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000602
Family CCCH zinc finger 0.0014
Further Details:      
 
Domain Number 3 Region: 88-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000654
Family CCCH zinc finger 0.0022
Further Details:      
 
Domain Number 4 Region: 35-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000772
Family CCCH zinc finger 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400017335
Sequence length 284
Comment PGSC0003DMT400025445
Sequence
MDIRKRNRNETGFNGNGGFKKAKPEMDSLSSGIGSKSKPCTKFFSTVGCPFGENCHFLHY
VPGGYNAVAKIMNIAPSPASPIASGNTPAVKTKICSKFNTAEGCKFGDKCRFAHGEWEIG
KPIVPSPRAMGVGPIPDRFGGRREPPVSGAAASFGTSAIAKISVDAFHVGPIIGKGGVNS
KQICRQTGAKLAIREHEIDKNLRNIELEGTFEQISRASAMVRELISSLGSVGGPGRTPAV
QGGPAPPMSNYKTKLCENFAKGSCTFGERCHFAHGDAELRKTGG
Download sequence
Identical sequences M1ALF9
XP_006344031.1.80749 PGSC0003DMP400017335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]