SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400021366 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400021366
Domain Number 1 Region: 38-129
Classification Level Classification E-value
Superfamily HMG-box 3.67e-19
Family HMG-box 0.00093
Further Details:      
 
Domain Number 2 Region: 192-251
Classification Level Classification E-value
Superfamily HMG-box 0.00000000497
Family HMG-box 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400021366
Sequence length 256
Comment PGSC0003DMT400031520
Sequence
MEKCKHEAMRLLDDEQKQKTAMELLEQYIQFQQGSIVNENKKKKKEKDPLKPKQPLSAFF
MFTNDRRAALLSENNNNVKEATKITGEEWKNMIEQQNAPYEEMAMTKKGKYLQEMKVYKK
NNKDEEAADHTKEGEQSMKLKNQEALQLLKKKEKIEKLIKKIAKRRNRKKTMWILTNQRI
LLHHSSVSVEREKKLVEKHPGINDSTINVLISLKWKELSEEENQVWNNATVEAMESYKNE
MEEHNKTAAKKQNNNN
Download sequence
Identical sequences M1AVS9
PGSC0003DMP400021366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]