SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400022502 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400022502
Domain Number 1 Region: 189-230
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000589
Family Rho termination factor, N-terminal domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400022502
Sequence length 233
Comment PGSC0003DMT400033069
Sequence
MLNPIKKDRNKQLEKFKGELQVKQSPKSQVLTIHKSNSIFSQKLESQRLKFKWKVPTEMA
KEPCLAEELGFKSPSGLKLKRQLKTGSTKENGGDESRDKTTKESLSPLGGAKGTGDLPEI
SSTSLIHLKKRRITSSTGPILQENENLRDFQNRLVKSYDRSNQNLKVIKVENDELLDSPT
FTVPIPDKTDLKYMTMNQLRAVARHHNVHGVYKFRKAELQEHLHKLLAKGRST
Download sequence
Identical sequences M1AYK2
PGSC0003DMP400022502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]