SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400022624 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400022624
Domain Number 1 Region: 609-800
Classification Level Classification E-value
Superfamily Sec7 domain 2.49e-77
Family Sec7 domain 0.00000142
Further Details:      
 
Domain Number 2 Region: 396-547,915-972,1128-1296,1329-1394,1424-1493,1569-1605
Classification Level Classification E-value
Superfamily ARM repeat 1.4e-16
Family Armadillo repeat 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400022624
Sequence length 1778
Comment PGSC0003DMT400033251
Sequence
MASSEADSRLNQVLIPALEKIIKNGSWRKHSKLSHECKSVIDFLTNPSSTPPTSPSAEPD
PDSAAHPGVLLDLSFNDSELILSPFINAAGSGHLKIAEAALDAVQKLVAHGYLRGEADPT
GGPDAKFLAKLIESVCKCHDLGDDAVELLVIKTILSAVTSVSIRIHGDSLLQVVRTCYDI
YLESKNVVNQTTAKASLVQMLVIVFRRMEADSSTVPLQPIVVAELMEPAEKADADGSMTL
FVQGFITKVLQDIDGVFNAGTPRVGATTTGAHDGAFETTTSTVESTNPADLLDSTDKDML
DAKYWEISMYKTALEGRKGELVDGEGERDDDLEVQIGNKLRRDAFLVFRALCKLSMKTPP
KEAAADPQLMRGKIVALELLKILLENAGAIFRTSDRFLGAIKQYLCLSLLKNSASSLMIV
FQLSCSIFISLVARFRAGLKAEIGVFFPMIVLRVLENVAQPNFQQKMIVLRFLERLCIDS
QILVDIFLNYDCDVNSSNIFERMVNGLLKTAQGIPPGTTTTLLPPQESTMKLEAMRCLVA
ILKSLGDWMNKHLRIADPLSTKKYEAPDSNSEPGILPITNGIEDEPTEVSDSHSESSSEV
SDVSTIEQRRAYKLELQEGISLFNRKPKKGIEFLINANKVGNSPEQIAAFLKDASGLNKT
LIGDYLGERDDLPLKVMHAYVDSFDFQGKEFDEAIRAFLQGFRLPGEAQKIDRIMEKFAE
RYCKCNPKVFSSADTAYVLAFSVILLNTDAHNPTIKTKMSADDFIRNNRGIDDGKDVPEE
YLRSLFERISKNEIKMKDDNLALQQKQSLNSNRILDLDNILNIVVRKRGDESMETSDDLV
RHMQEQFKEKARKSESVYYAATDVVILRFMVEVCWAPMLAAFSVPLDQADDGVVIALCLE
GFRCAIHVTAAMSMKTHRDAFVTSLAKFTSLHSPADIKQKNIDAIKAIITIAEEDGNYLQ
EAWEHILTCVSRFEHLHLLGEGAPPDATFFALPQNEFDKSKQAKSLILPVLKKKGPGKIQ
SAASAMRRGSYDSAGIGGSASAGITSEQMNNLVSNLNMLEQVGEMNRIFIRSQKLNSEAI
VDFVKALCKVSMEELRSTSDPRVFSLTKIVEIAHYNMNRIRFVWTKIWQVLGEFFVTIGC
SENLSIAIFAMDSLRQLSMKFLEREELANYNFQNEFMKPFVIVMRKSSAVEIRELIIRCV
SQMVLSRVNHVKSGWKSMFMVFTTAAYDDHKNIVLLAFEIMEKIVRDYFPYITETETTTF
TDCVNCLVAFTNSRFNKDISLNAIAFLRLCAAKLAEGDLGSSRNKDRETSVKVSPSSPHK
GKDHNIENGELTDKEDHLYFWFPLLAGLSELSFDPRPEIRKSALQVLFDTLRNYGHHFSL
SLWERVFESVLFPIFDYVRHTIDPSGENSPTHGIDAEEGEPDQDSWLYETCTLALQLVVD
LFVKFYDTVNPLLKKVLFLLVNFVKRPHQSLAGIGIAAFVRLMSNAGSLFSEDKWLEVVL
SIKEAANATIPDFSFLLNENNNYWSQEEDMTGNGNAETTGTDTPDEDLENLRRHRLYDAI
ADVKCRAAVQLLLIQAVMEIYNMYRPQLSSKNIIVLFDAMHGVASHAHKINSDTTLRSKL
LEFSSMTQMQDPPLLRLENEAYQICLSFLQNLVLDKPTGFEDSDVETYLINLCSEVLHFY
IEIAHSGQMSESSLGAQLRWLIPLGSGRRRELAARAPLIIATLQAICSLGDASFEKNLSG
FFPLLSSLISCEHGSNEIQLALSDMLSSSVGPVLLRSC
Download sequence
Identical sequences M1AYU6
PGSC0003DMP400022624 XP_006339441.1.80749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]