SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400024491 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400024491
Domain Number 1 Region: 70-176
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.09e-27
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400024491
Domain Number - Region: 349-403
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400024491
Sequence length 463
Comment PGSC0003DMT400036054
Sequence
MLFHLLLYCFYVVFSSANTSDTISSSEPVRDSETVFSRGKRFKLGFFSPRNSAKRYVGIM
FNLPSPTPTVVWVANRDEPLHDSSGILTISEDSNLVMLNGQKEIIWSSSISNSMKNSTAQ
LLDTGNLVLKDSSNGRVLWESFQYPTDSLLQLMKMGTDKRTNTTTLLNSWGSPDDPSVGS
FSAGIQHRYIPQFLIWKNSSPYWRGGPWNKQIYIGLPEMNSFYLYGIDLVIDNAGTAYQT
YSDPNQSRILYYSLNSTGSYQEKVWDQSKKDWVVTWANPRTECDFYAKCGTYGSCNPMNS
PICSCIQGFKPKNDGEWKKGDWSGGCIRSTALDCERNKTDIEKDKQDGFLKLQTMGVPDF
VISVPSAKKDCESDCLSNCSCTAYSYYRGIGCMHWNRSLVDIQEYSRDGAASLFIRLAYS
ELAANDKKDIPVAAIATTVSIGSITVILCGYLFWKLLAKHRGN
Download sequence
Identical sequences M1B371
PGSC0003DMP400024490 PGSC0003DMP400024491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]