SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400030283 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400030283
Domain Number 1 Region: 104-180,207-231
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.55e-27
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400030283
Domain Number - Region: 384-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0432
Family Anti-platelet protein 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400030283
Sequence length 448
Comment PGSC0003DMT400044674
Sequence
MALCKIIPFAFILLCCSCYLISGQRFDYPTANLSTTWINSVSAPHSVDFTDGSRVRAILL
RGTFGPKYACGFYCNGNCDTYLFAIFIVQTNSASQITSPAIGFPQVVWSANRNNPVKINS
TLQLTAQGDLVLRNADGTLAWSTNTAGKSVAGLSLTDEGNLVLFDLKNATVWQSFDHPTD
ALVPGQKLVSGMKLTASVSTTNWTKGGLFSLSAIDNGLVAFIESNPPQTYFDATIGGLDP
SGGSNYVKYLDGSLTFFTNSSGTTELVLVSITPASSAQYMKLESNGHLKVYEWKNRWGEV
DDLLTGFRGVCNYPTVCGRYGICTMGQCSCPISSNSTTYFRPINVRLPNLGCSEAKKLTC
NNLKKHRLLEVEDVDYFAFTADISNTDVNTCKRACLNKCSCKAAFFRSGLNSSRAIGECY
LPTEIFSLMNNEKDKTRYDSVAFIKVQV
Download sequence
Identical sequences M1BGH8
PGSC0003DMP400030283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]