SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400033424 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400033424
Domain Number 1 Region: 77-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.97e-31
Family alpha-D-mannose-specific plant lectins 0.0046
Further Details:      
 
Weak hits

Sequence:  PGSC0003DMP400033424
Domain Number - Region: 344-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00302
Family Hairpin loop containing domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400033424
Sequence length 473
Comment PGSC0003DMT400049514
Sequence
MKELLRESFHLFLLMYLYFVQRSIGATDTISTTHFLKDGDANITSPDGTFEMGFFSSGSS
KNRYVGMWYKSLSVRTVVWVANREAPLTSGSGILKVIEPGRLVLLNDTNKVVWSTNTSTS
VQNPIAQLLDSGNLVVKQAGDDNFLWQSFDHPTDTLLPGMKLGWNFLTHREVYLSSWKTQ
EDPAPGDYTYHCDPSGYPQNILKKGSNVVYRSGPWNGLHFSGTRNPRGSHLYKYEIFSSK
TQVYFGYKLISSVITRLILNQNGALKLWTWGDHVSDWIPQLSIPADNCDAYKLCGAYGTC
NSQDFTVCRCLDRFVPNNSEAWKKRNWSGGCVRKTELNCLQGHRFLKYSHIKLPDTRNSW
SDVTMTLEECKNTCSKNCSCMAYANPDIRNGGSGCLLWFEDLLDIKVVSDEGQDIYIRMA
ASEPDSLEKSDGKKRKVLFWILPLSVGLILVILSMLIFHRRRKKALQLKRKGR
Download sequence
Identical sequences M1BNW1
PGSC0003DMP400033423 PGSC0003DMP400033424 PGSC0003DMP400033425 PGSC0003DMP400033427 PGSC0003DMP400033428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]