SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGSC0003DMP400033496 from Solanum tuberosum

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGSC0003DMP400033496
Domain Number 1 Region: 99-208
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-25
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGSC0003DMP400033496
Sequence length 362
Comment PGSC0003DMT400049625
Sequence
MEYVKFFLTILKKNAMQQKVNITIMDITIFQFILLLLYFVFLQNVSGQGDTITTTQFIKH
GDTIVSSHGTFELGFFSPGDTSTNHYVGIWYKKTSATTPVWVANRLAPVANKYGVLKVIQ
PGLIVLLNDTNATVWSTNSSKSVQNPVAQLLDTGNFVVRDANDPNPENFLWQSFDYPSDT
LLEGMKLGTDLVTGLERYLTSWRSSDDPAPGDYTYHCDPTGYPQNLMRKGANVTFRAGPW
NGIRWSGAPNLVNNSIISFGMVMNSREIYYKYEMVNKSVISTFVLEPYGKAMRIIWIGKV
QGWVNYHSAVVDDCDTYKLCGAYGTCNILSDPFCQCLDNSSQNILIIGKGLTGLVVVSGR
SH
Download sequence
Identical sequences M1BP24
PGSC0003DMP400033494 PGSC0003DMP400033495 PGSC0003DMP400033496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]